Rabbit anti‑Human ABCA4 IgG Polyclonal RW-C497265-20

Antibody: ABCA4 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCA4 antibody RW-C497265 is an unconjugated rabbit polyclonal antibody to ABCA4 from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human ABCA4, Synonym: ABCA4 | ABCR | ABC10 | ARMD2 | CORD3 | FFM | RIM ABC transporter | RIM protein | RMP | RP19 | STGD | Photoreceptor rim protein | Stargardt disease protein | STGD1, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 110-300 of human ABCA4 (NP_000341.2). QELLMNAPESQHLGRIWTELHILSQFMDTLRTHPERIAGRGIRIRDILKDEETLTLFLIKNIGLSDSVVYLLINSQVRPEQFAHGVPDLALKDIACSEALLERFIIFSQRRGAKTVRYALCSLSQGTLQWIEDTLYANVDFFKLFRVLPTLLDSRSQGINLRSWGGILSDMSPRIQEFIHRPSMQDLLWVT, Application: Western blot (1:1000 - 1:2000), Usag: The predicted MW is 255kDa, while the observed MW by Western blot was 256kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCA: Uniprot: P78363 NCBI: NM_000350 NP_000341.2

Cat: RW-52-1080-64