Rabbit anti‑Human ABCB2 / TAP1 Polyclonal RW-C408034-10

Antibody: ABCB2 / TAP1 Rabbit anti-Human Polyclonal (aa438-471) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: TAP1 antibody RW-C408034 is an unconjugated rabbit polyclonal antibody to human TAP1 (ABCB2) (aa438-471). Validated for IHC and WB., Targe: Human ABCB2 / TAP1, Synonym: TAP1 | ABC17 | ABCB2 | APT1 | D6S114E | ABC transporter, MHC 1 | Ham1 | Peptide transporter TAP1 | PSF1 | TAP1N | MTP1 | Peptide transporter PSF1 | PSF-1 | Peptide supply factor 1 | RING4 | Y3, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471 aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids., Epitop: aa438-471, Application: IHC
IHC - Paraffin (0.5 - 1 µg/ml)
Western blot (0.1 - 0.5 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB2 / TAP: Uniprot: Q03518 NCBI: NM_000593 NP_000584.2

Cat: RW-52-1461-102