Rabbit anti‑Human ABCB7 IgG Polyclonal RW-C749680-20

Antibody: ABCB7 Rabbit anti-Human Polyclonal Antibody, Application: IHC, IF, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ABCB7 antibody RW-C749680 is an unconjugated rabbit polyclonal antibody to ABCB7 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB., Targe: Human ABCB7, Synonym: ABCB7 | ABC transporter 7 protein | ABC7 | Atm1p | ATP-binding cassette 7 | ASAT | EST140535, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 503-753 of human ABCB7 (NP_004290.2). AIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEIVNSVKGCGNCSC, Application: IHC (1:50 - 1:200)
Immunofluorescence (1:50 - 1:200)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 78kDa/82kDa, while the observed MW by Western blot was 83kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCB: Uniprot: O75027 NCBI: NM_004299 BAA28861.1

Cat: RW-52-1571-65