Rabbit anti‑Human ABCC8 / SUR1 Polyclonal RW-C662588-10
Antibody: ABCC8 / SUR1 Rabbit anti-Human Polyclonal Antibody, Application: IHC, ICC, WB, Flo, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: SUR1 antibody RW-C662588 is an unconjugated rabbit polyclonal antibody to human SUR1 (ABCC8). Validated for Flow, ICC, IHC and WB., Targe: Human ABCC8 / SUR1, Synonym: ABCC8 | ABC36 | HI | PHHI | Sulfonylurea receptor | SUR | Sulfonylurea receptor 1 | MRP8 | SUR1delta2 | HHF1 | HRINS | SUR1 | TNDM2, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA)., Application: IHC
ICC
Western blot
Flow Cytometry, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose, Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC8 / SUR: Uniprot: Q09428 NCBI: NM_000352 NP_000343.2
Cat:
RW-52-2048-124
Support & questions : Raed@gentaur.com
Read also :