Rabbit anti‑Human ABCG8 Polyclonal RW-C662100-10

Antibody: ABCG8 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: ABCG8 antibody RW-C662100 is an unconjugated rabbit polyclonal antibody to human ABCG8. Validated for WB., Targe: Human ABCG8, Synonym: ABCG8 | Sterolin-2 | STSL | GBD4 | Sterolin 2, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371 aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids., Specificit: Strongly expressed in the liver, lower levels in the small intestine and colon. Detectable in a wide variety of human tissues., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose, Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCG: Uniprot: Q9H221 NCBI: NM_022437 NP_071882.1

Cat: RW-52-2389-70