Rabbit anti‑Human ABRI / ITM2B IgG Polyclonal RW-C749805-20

Antibody: ABRI / ITM2B Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: ITM2B antibody RW-C749805 is an unconjugated rabbit polyclonal antibody to ITM2B (ABRI) from human. It is reactive with human and mouse. Validated for WB., Targe: Human ABRI / ITM2B, Synonym: ITM2B | ABri/ADan amyloid peptide | ABRI | BRI | BRI2 | E3-16 | Integral membrane protein 2B | ImBRI2 | FBD | Protein E25B | BRICD2B | BRICHOS domain containing 2B | Transmembrane protein BRI | E25B | Immature BRI2, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 81-266 of human ITM2B (NP_068839.1). LQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 18kDa/30kDa, while the observed MW by Western blot was 35kDa, 38kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABRI / ITM2: Uniprot: Q9Y287 NCBI: NM_021999 NP_068839.1

Cat: RW-52-3064-131