Rabbit anti‑Human ACAA1 IgG Polyclonal RW-C749991-20

Antibody: ACAA1 Rabbit anti-Human Polyclonal Antibody, Application: IF, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ACAA1 antibody RW-C749991 is an unconjugated rabbit polyclonal antibody to ACAA1 from human. It is reactive with human, mouse and rat. Validated for IF and WB., Targe: Human ACAA1, Synonym: ACAA1 | Acetyl-CoA acyltransferase 1 | ACAA | Acetyl-CoA acyltransferase | Beta-ketothiolase | THIO | PTHIO, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 27-300 of human ACAA1 (NP_001598.1). LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI, Application: Immunofluorescence (1:50 - 1:200)
Western blot (1:500 - 1:2000), Usag: The predicted MW is 34kDa/44kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACAA: Uniprot: P09110 NCBI: NM_001607 NP_001598.1

Cat: RW-52-3103-63