Rabbit anti‑Human ACADSB IgG Polyclonal RW-C749995-20
Antibody: ACADSB Rabbit anti-Human Polyclonal Antibody, Application: IF, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: ACADSB antibody RW-C749995 is an unconjugated rabbit polyclonal antibody to human ACADSB. Validated for IF., Targe: Human ACADSB, Synonym: ACADSB | 2-MEBCAD | ACAD7 | SBCAD, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 133-432 of human ACADSB (NP_001600.1). ASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAEY, Application: Immunofluorescence (1:50 - 1:200), Usag: The predicted MW is 36kDa/47kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACADS: Uniprot: P45954 NCBI: NM_001609 NP_001600.1
Cat:
RW-52-3332-87
Support & questions : Raed@gentaur.com
Read also :