Rabbit anti‑Human ACADSB IgG Polyclonal RW-C749995-20

https://www.antybuddy.com/web/image/product.template/158229/image_1920?unique=90babdb
(0 review)

Antibody: ACADSB Rabbit anti-Human Polyclonal Antibody, Application: IF, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: ACADSB antibody RW-C749995 is an unconjugated rabbit polyclonal antibody to human ACADSB. Validated for IF., Targe: Human ACADSB, Synonym: ACADSB | 2-MEBCAD | ACAD7 | SBCAD, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 133-432 of human ACADSB (NP_001600.1). ASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAEY, Application: Immunofluorescence (1:50 - 1:200), Usag: The predicted MW is 36kDa/47kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACADS: Uniprot: P45954 NCBI: NM_001609 NP_001600.1

503.00 € 503.0 EUR 503.00 € VAT Excluded

503.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-3332-87

    Support & questions : Raed@gentaur.com


    Read also :

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.