Rabbit anti‑Human ACADVL IgG Polyclonal RW-C409413-20

Antibody: ACADVL Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ACADVL antibody RW-C409413 is an unconjugated rabbit polyclonal antibody to ACADVL from human. It is reactive with human, mouse and rat. Validated for IHC and WB., Targe: Human ACADVL, Synonym: ACADVL | ACAD6 | LCACD | VLCAD, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ACADVL (NP_000009.1). MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPAKNDALEMVEETTWQGLKELG, Specificit: Human ACADVL, Application: IHC (1:50 - 1:200)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 68kDa/70kDa/72kDa, while the observed MW by Western blot was 70kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACADV: Uniprot: P49748 NCBI: NM_000018 NP_000009.1

Cat: RW-52-3356-100