Rabbit anti‑Human ACCS / ACS IgG Polyclonal RW-C748490-20
Antibody: ACCS / ACS Rabbit anti-Human Polyclonal Antibody, Application: IHC, IF, WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: ACS antibody RW-C748490 is an unconjugated rabbit polyclonal antibody to ACS (ACCS) from human. It is reactive with human and mouse. Validated for IF, IHC and WB., Targe: Human ACCS / ACS, Synonym: ACCS | ACS | ACC synthase-like protein 1 | PHACS, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 222-501 of human ACCS (NP_115981.1). LDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRPSQSQEPSDQRR, Application: IHC (1:50 - 1:200)
Immunofluorescence (1:50 - 1:200)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 17kDa/57kDa, while the observed MW by Western blot was 57kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACCS / AC: Uniprot: Q96QU6 NCBI: NM_032592 NP_115981.1
Cat:
RW-52-3787-106
Support & questions : Raed@gentaur.com
Read also :