Rabbit anti‑Human ACO1 / Aconitase IgG Polyclonal RW-C409416-20

Antibody: ACO1 / Aconitase Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: Aconitase antibody RW-C409416 is an unconjugated rabbit polyclonal antibody to Aconitase (ACO1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB., Targe: Human ACO1 / Aconitase, Synonym: ACO1 | ACONS | Aconitase | Aconitase 1, soluble | Aconitate hydratase | Citrate hydro-lyase | IREB1 | IRE-BP 1 | IREBP | IRP1 | Ferritin repressor protein | IREBP1 | Iron regulatory protein 1, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ACO1 (NP_002188.1). MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRII, Specificit: Human ACO1 / Aconitase, Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 98kDa, while the observed MW by Western blot was 120kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACO1 / Aconitas: Uniprot: P21399 NCBI: NM_002197 NP_002188.1

Cat: RW-52-4550-163