Rabbit anti‑Human ACO2 / Aconitase 2 IgG Polyclonal RW-C781792-100

Antibody: ACO2 / Aconitase 2 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: Aconitase 2 antibody RW-C781792 is an unconjugated rabbit polyclonal antibody to Aconitase 2 (ACO2) from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human ACO2 / Aconitase 2, Synonym: ACO2 | ACONM | Aconitase 2 | Aconitase 2, mitochondrial | Citrate hydro-lyase | ICRD, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antigen Affinity purification, Modification: Unmodified, Immunoge: Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody., Application: Western blot (0.1 - 0.5 µg/ml), Usag: Applications should be user optimized., Presentatio: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide., Reconstitutio: Reconstitute with 0.2ml distilled water, Storag: Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACO2 / Aconitase : Uniprot: Q99798 NCBI: NM_001098 NP_001089.1

Cat: RW-52-4604-163