Rabbit anti‑Human AADAC IgG Polyclonal RW-C497073-20

Antibody: AADAC Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: AADAC antibody RW-C497073 is an unconjugated rabbit polyclonal antibody to AADAC from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human AADAC, Synonym: AADAC | CES5A1 | DAC | Arylacetamide deacetylase, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 170-399 of human AADAC (NP_001077.2). KKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 45kDa, while the observed MW by Western blot was 46kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AADA: Uniprot: P22760 NCBI: NM_001086 NP_001077.2

Cat: RW-52-464-67