Rabbit anti‑Human ACOT9 IgG Polyclonal RW-C750384-20

Antibody: ACOT9 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: ACOT9 antibody RW-C750384 is an unconjugated rabbit polyclonal antibody to ACOT9 from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human ACOT9, Synonym: ACOT9 | ACATE2 | Acyl-CoA thioester hydrolase 9 | Acyl-CoA thioesterase 9 | MTACT48 | CGI-16 | MT-ACT48, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 22-250 of human ACOT9 (NP_001028755.2). LTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLK, Application: Western blot (1:200 - 1:2000), Usag: The predicted MW is 43kDa/46kDa/49kDa/50kDa, while the observed MW by Western blot was 50kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACOT: Uniprot: Q9Y305 NCBI: AF132950 AAD27725.1

Cat: RW-52-4795-96