Rabbit anti‑Human ACP1 / Acid Phosphatase IgG Polyclonal RW-C747495-20
Antibody: ACP1 / Acid Phosphatase Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: Acid Phosphatase antibody RW-C747495 is an unconjugated rabbit polyclonal antibody to Acid Phosphatase (ACP1) from human. It is reactive with human and mouse. Validated for IHC and WB., Targe: Human ACP1 / Acid Phosphatase, Synonym: ACP1 | Acid Phosphatase | Acid phosphatase 1, soluble | Acid phosphatase 1 soluble | Adipocyte acid phosphatase | LMW-PTP | HAAP | Red cell acid phosphatase 1 | LMW-PTPase | Protein tyrosine phosphatase, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human ACP1 (NP_009030.1). MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH, Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 12kDa/14kDa/17kDa/18kDa, while the observed MW by Western blot was 18kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACP1 / Acid Phosphatas: Uniprot: P24666 NCBI: NM_004300 NP_004291.1
Cat:
RW-52-4947-222
Support & questions : Raed@gentaur.com
Read also :