Rabbit anti‑Rat Beta Endorphin IgG Polyclonal RW-C23037-50

Antibody: Beta Endorphin Rabbit anti-Rat Polyclonal Antibody, Application: IHC, Reactivity: Rat, Format: Unconjugated, Unmodified, Descriptio: Beta Endorphin antibody RW-C23037 is an unconjugated rabbit polyclonal antibody to rat Beta Endorphin. Validated for IHC., Targe: Rat Beta Endorphin, Hos: Rabbit, Reactivit: Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antiserum, Modification: Unmodified, Immunoge: YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE. Percent identity by BLAST analysis: Baboon, Elephant (97%); Frog (87%)., Specificit: Recognizes rat beta-Endorphin., Application: IHC (1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: Suitable for use in Immunohistochemistry. Immunohistochemistry: 1:2000., Storag: Short term: 4°C; Long term: Add glycerol (40-50%) -20°C., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee.

Cat: RW-52-51823-170