Rabbit anti‑Human ACRV1/Intra-Acrosomal Protein IgG Polyclonal RW-C409633-20

Antibody: ACRV1/Intra-Acrosomal Protein Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: Intra-Acrosomal Protein antibody RW-C409633 is an unconjugated rabbit polyclonal antibody to Intra-Acrosomal Protein (ACRV1) from human. It is reactive with human and mouse. Validated for WB., Targe: Human ACRV1/Intra-Acrosomal Protein, Synonym: ACRV1 | Acrosomal protein SP-10 | D11S4365 | Acrosomal vesicle protein 1 | Sperm protein 10 | SP-10 | SPACA2, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 22-265 of human ACRV1 (NP_001603.1). QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI, Specificit: Human ACRV1/Intra-Acrosomal Protein, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 9kDa/13-28kDa, while the observed MW by Western blot was 36kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ACRV1/Intra-Acrosomal Protei: Uniprot: P26436 NCBI: NM_001612 NP_001603.1

Cat: RW-52-5281-357