Rabbit anti‑Human CASP9 / Caspase 9 IgG Polyclonal RW-C746977-20
Antibody: CASP9 / Caspase 9 Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: Caspase 9 antibody RW-C746977 is an unconjugated rabbit polyclonal antibody to Caspase 9 (CASP9) from human. It is reactive with human, mouse and rat. Validated for IHC and WB., Targe: Human CASP9 / Caspase 9, Synonym: CASP9 | APAF3 | CASPASE-9c | ICE-LAP6 | MCH6 | ICE-like apoptotic protease 6 | APAF-3 | Apoptotic protease Mch-6 | CASP-9 | Caspase 9 | Caspase-9 | PPP1R56, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CASP9 (NP_001220.2). VYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG, Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 17kDa/30kDa/36kDa/46kDa, while the observed MW by Western blot was 46kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CASP9 / Caspase : Uniprot: P55211 NCBI: NM_001229 NP_001220.2
Cat:
RW-52-62582-160
Support & questions : Raed@gentaur.com
Read also :