Rabbit anti‑Human CAST / Calpastatin Polyclonal RW-C661953-10

https://www.antybuddy.com/web/image/product.template/217791/image_1920?unique=3fee582
(0 review)

Antibody: CAST / Calpastatin Rabbit anti-Human Polyclonal Antibody, Application: IHC, IHC-P, IHC-Fr, ICC, WB, Flo, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: Calpastatin antibody RW-C661953 is an unconjugated rabbit polyclonal antibody to human Calpastatin (CAST). Validated for Flow, ICC, IHC and WB., Targe: Human CAST / Calpastatin, Synonym: CAST | Calpastatin | BS-17 | Calpain inhibitor | Sperm BS-17 component, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310 aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino, Application: IHC
IHC - Paraffin
IHC - Frozen
ICC
Western blot
Flow Cytometry, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CAST / Calpastati: Uniprot: P20810 NCBI: NM_001750 NP_001741.4

470.00 € 470.0 EUR 470.00 € VAT Excluded

470.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-62894-216

    Support & questions : Raed@gentaur.com


    Read also :

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.