Rabbit anti‑Human CAT / Catalase IgG Polyclonal RW-C747130-20

Antibody: CAT / Catalase Rabbit anti-Human Polyclonal Antibody, Application: WB, IP, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: Catalase antibody RW-C747130 is an unconjugated rabbit polyclonal antibody to Catalase (CAT) from human. It is reactive with human, mouse and rat. Validated for IP and WB., Targe: Human CAT / Catalase, Synonym: CAT | Catalase, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human CAT (NP_001743.1). MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNA, Application: Western blot (1:1000 - 1:3000)
Immunoprecipitation (1:20 - 1:50), Usag: The predicted MW is 59kDa, while the observed MW by Western blot was 60kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CAT / Catalas: Uniprot: P04040 NCBI: NM_001752 NP_001743.1

Cat: RW-52-62923-143