Rabbit anti‑Human CAV1 / Caveolin 1 IgG Polyclonal RW-C746784-20

Antibody: CAV1 / Caveolin 1 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: Caveolin 1 antibody RW-C746784 is an unconjugated rabbit polyclonal antibody to Caveolin 1 (CAV1) from human. It is reactive with human and mouse. Validated for WB., Targe: Human CAV1 / Caveolin 1, Synonym: CAV1 | Caveolin-1 | CGL3 | CAV | MSTP085 | VIP21 | BSCL3, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CAV1 (NP_001744.2). MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 17kDa/20kDa, while the observed MW by Western blot was 20kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CAV1 / Caveolin : Uniprot: Q03135 NCBI: NM_001753 NP_001744.2

Cat: RW-52-63162-164