Rabbit anti‑Human CBFA1 / RUNX2 Polyclonal RW-C344017-10

Antibody: CBFA1 / RUNX2 Rabbit anti-Human Polyclonal (aa244-278) Antibody, Application: WB, Reactivity: Human, Chimpanzee, Gibbon, Mouse, Pig, Format: Unconjugated, Unmodified, Descriptio: RUNX2 antibody RW-C344017 is an unconjugated rabbit polyclonal antibody to RUNX2 (CBFA1) (aa244-278) from human. It is reactive with human, mouse, chimpanzee and other species. Validated for WB., Targe: Human CBFA1 / RUNX2, Synonym: RUNX2 | AML3 | CCD | CCD1 | OSF2 | PEBP2A1 | PEBP2A2 | PEA2-alpha A | PEBP2-alpha A | OSF-2 | PEBP2A | PEBP2aA1 | CBF-alpha-1 | CBFA1 | Oncogene AML-3 | PEA2aA | PEBP2aA, Hos: Rabbit, Reactivit: Human, Chimpanzee, Gibbon, Mouse, Pig (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278 aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence., Epitop: aa244-278, Specificit: Specifically expressed in osteoblasts., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CBFA1 / RUNX: Uniprot: Q13950 NCBI: NM_004348 NP_004339.3

Cat: RW-52-63391-146