Rabbit anti‑Human CBFA2T3 IgG Polyclonal RW-C749694-20

Antibody: CBFA2T3 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: CBFA2T3 antibody RW-C749694 is an unconjugated rabbit polyclonal antibody to human CBFA2T3. Validated for WB., Targe: Human CBFA2T3, Synonym: CBFA2T3 | ETO2 | MTG8-related gene 2 | MTGR2 | MTG16 | MTG8-related protein 2 | Protein CBFA2T3 | Translocated to, 3 | ZMYND4 | HMTG16, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 305-390 of human CBFA2T3 (NP_005178.4). DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 7kDa/62kDa/63kDa/71kDa, while the observed MW by Western blot was 60kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CBFA2T: Uniprot: O75081 NCBI: NM_005187 NP_005178.4

Cat: RW-52-63446-89