Rabbit anti‑Human CBX1 / HP1 Beta IgG Polyclonal RW-C332010-20

https://www.antybuddy.com/web/image/product.template/218800/image_1920?unique=3fee582
(0 review)

Antibody: CBX1 / HP1 Beta Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: HP1 Beta antibody RW-C332010 is an unconjugated rabbit polyclonal antibody to human HP1 Beta (CBX1). Validated for IHC and WB., Targe: Human CBX1 / HP1 Beta, Synonym: CBX1 | CBX | Chromobox protein homolog 1 | HP1 beta | HP1Hs-beta | Heterochromatin protein 1-beta | HP1Hsbeta | M31 | Modifier 1 protein | MOD1 | HP1 beta homolog | HP1-BETA | Chromobox homolog 1 | Heterochromatin protein p25 | p25beta, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human CBX1 (NP_006798.1). MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN, Specificit: Human CBX1 / HP1 Beta, Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:1000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 21kDa, while the observed MW by Western blot was 24kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CBX1 / HP1 Bet: Uniprot: P83916 NCBI: NM_006807 NP_006798.1

503.00 € 503.0 EUR 503.00 € VAT Excluded

503.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-63903-138

    Support & questions : Raed@gentaur.com


    Read also :

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.