Rabbit anti‑Human CBX6 IgG Polyclonal RW-C334116-20

Antibody: CBX6 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: CBX6 antibody RW-C334116 is an unconjugated rabbit polyclonal antibody to CBX6 from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human CBX6, Synonym: CBX6 | Chromobox homolog 6 | Chromobox protein homolog 6, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3). LLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV, Specificit: Human CBX6, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 43kDa, while the observed MW by Western blot was 50kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CBX: Uniprot: O95503 NCBI: NM_014292 NP_055107.3

Cat: RW-52-64170-86