Rabbit anti‑Human CCBL1 IgG Polyclonal RW-C334786-20

https://www.antybuddy.com/web/image/product.template/219286/image_1920?unique=3fee582
(0 review)

Antibody: CCBL1 Rabbit anti-Human Polyclonal Antibody, Application: IHC, IF, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: CCBL1 antibody RW-C334786 is an unconjugated rabbit polyclonal antibody to CCBL1 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB., Targe: Human CCBL1, Synonym: CCBL1 | Beta-lysase, kidney | KAT1 | KATI | Kynurenine aminotransferase I | Kyneurenine aminotransferase | Kynurenic acid transferase 1 | GTK | Glutamine transaminase K, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CCBL1 (NP_001116144.1). MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHM, Specificit: Human CCBL1 / KAT1, Application: IHC (1:50 - 1:200)
Immunofluorescence (1:10 - 1:100)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 27kDa/42kDa/47kDa, while the observed MW by Western blot was 48kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCBL: Uniprot: Q16773 NCBI: NM_004059 NP_004050.3

503.00 € 503.0 EUR 503.00 € VAT Excluded

503.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-64389-77

    Support & questions : Raed@gentaur.com


    Read also :

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.