Rabbit anti‑Human CCDC6 IgG Polyclonal RW-C781849-100
Antibody: CCDC6 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Rat, Format: Unconjugated, Unmodified, Descriptio: CCDC6 antibody RW-C781849 is an unconjugated rabbit polyclonal antibody to CCDC6 from human. It is reactive with human and rat. Validated for WB., Targe: Human CCDC6, Synonym: CCDC6 | D10S170 | H4 | Protein H4 | TPC | TST1 | PTC, Hos: Rabbit, Reactivit: Human, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antigen Affinity purification, Modification: Unmodified, Immunoge: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody., Application: Western blot (0.5 - 1 µg/ml), Usag: Applications should be user optimized., Presentatio: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide., Reconstitutio: Reconstitute with 0.2ml distilled water, Storag: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCDC: Uniprot: Q16204 NCBI: NM_005436 NP_005427.2
Cat:
RW-52-65267-70
Support & questions : Raed@gentaur.com
Read also :