Rabbit anti‑Human CCDC6 Polyclonal RW-C662336-10

Antibody: CCDC6 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: CCDC6 antibody RW-C662336 is an unconjugated rabbit polyclonal antibody to human CCDC6. Validated for WB., Targe: Human CCDC6, Synonym: CCDC6 | D10S170 | H4 | Protein H4 | TPC | TST1 | PTC, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence at the N-Terminus of human CCDC6 (156-198 aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence., Specificit: Ubiquitously expressed., Application: Western blot, Presentatio: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide., Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCDC: Uniprot: Q16204 NCBI: NM_005436 NP_005427.2

Cat: RW-52-65287-70