Rabbit anti‑Human CCDC61 IgG Polyclonal RW-C497048-20

Antibody: CCDC61 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: CCDC61 antibody RW-C497048 is an unconjugated rabbit polyclonal antibody to CCDC61 from human. It is reactive with human and mouse. Validated for WB., Targe: Human CCDC61, Synonym: CCDC61, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 352-531 of human CCDC61 (NP_001073871.1). PSPSPTGGRALRFDPTAFVKAKERKQREIQMKQQQRNRLGSGGSGDGPSVSWSRQTQPPAALTGRGDAPNRSRNRSSSVDSFRSRCSSASSCSDLEDFSESLSRGGHRRRGKPPSPTPWSGSNMKSPPVERSHHQKSLANSGGWVPIKEYSSEHQAADMAEIDARLKALQEYMNRLDMRS, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 37kDa/57kDa, while the observed MW by Western blot was 68kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCDC6: NCBI: NM_001267723 NP_001254652.1

Cat: RW-52-65347-70