Rabbit anti‑Human CCK4 / PTK7 IgG Polyclonal RW-C411361-20

https://www.antybuddy.com/web/image/product.template/220770/image_1920?unique=c6c7720
(0 review)

Antibody: CCK4 / PTK7 Rabbit anti-Human Polyclonal Antibody, Application: IHC, WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: PTK7 antibody RW-C411361 is an unconjugated rabbit polyclonal antibody to PTK7 (CCK4) from human. It is reactive with human, mouse and rat. Validated for IHC and WB., Targe: Human CCK4 / PTK7, Synonym: PTK7 | CCK-4 | CCK4 | Colon carcinoma kinase 4 | Tyrosine-protein kinase-like 7 | Protein-tyrosine kinase 7 | PTK7 protein tyrosine kinase 7, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 811-1070 of human PTK7 (NP_002812.2). FLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP, Specificit: Human CCK4 / PTK7, Application: IHC (1:50 - 1:100)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 89kDa/103kDa/112kDa/113kDa/118kDa/119kDa, while the observed MW by Western blot was 80kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCK4 / PTK: Uniprot: Q13308 NCBI: NM_002821 NP_002812.2

503.00 € 503.0 EUR 503.00 € VAT Excluded

503.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-65873-121

    Support & questions : Raed@gentaur.com


    Read also :

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.