Rabbit anti‑Human CCKBR / Cckb IgG Polyclonal RW-C756503-100

https://www.antybuddy.com/web/image/product.template/220834/image_1920?unique=c6c7720
(0 review)

Antibody: CCKBR / Cckb Rabbit anti-Human Polyclonal (DY550) Antibody, Application: Flo, Reactivity: Human, Format: DyLight 550, Unmodified, Descriptio: Cckb antibody RW-C756503 is a DY550-conjugated rabbit polyclonal antibody to human Cckb (CCKBR). Validated for Flow., Targe: Human CCKBR / Cckb, Synonym: CCKBR | CCKB | Cholecystokinin-2 receptor | CCK-BR | CCK2 receptor | CCK2-R | CCKB-R | Cholecystokinin-B | GASR | CCK-B | CCK-B receptor | CCK2R | Cckb receptor | CCKRB | Cholecystokinin B receptor | Gastrin receptor, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: DyLight 550, Purificatio: Immunogen affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS)., Specificit: No cross reactivity with other proteins., Application: Flow Cytometry (1 - 3 µg/10E6 cells), Usag: Applications should be user optimized., Presentatio: 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol, Storag: Store at 4°C. Do not freeze. Protect from light., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCKBR / Cck: Uniprot: P32239 NCBI: NM_176875 NP_795344.1

571.00 € 571.0 EUR 571.00 € VAT Excluded

571.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Cat: RW-52-65937-113

    Support & questions : Raed@gentaur.com


    Read also :

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.