Rabbit anti‑Human CCKBR / Cckb IgG Polyclonal RW-C782111-100

Antibody: CCKBR / Cckb Rabbit anti-Human Polyclonal Antibody, Application: WB, Flo, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: Cckb antibody RW-C782111 is an unconjugated rabbit polyclonal antibody to Cckb (CCKBR) from human. It is reactive with human, mouse and rat. Validated for Flow and WB., Targe: Human CCKBR / Cckb, Synonym: CCKBR | CCKB | Cholecystokinin-2 receptor | CCK-BR | CCK2 receptor | CCK2-R | CCKB-R | Cholecystokinin-B | GASR | CCK-B | CCK-B receptor | CCK2R | Cckb receptor | CCKRB | Cholecystokinin B receptor | Gastrin receptor, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Antigen Affinity purification, Modification: Unmodified, Immunoge: Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody., Application: Western blot (0.5 - 1 µg/ml)
Flow Cytometry (1 - 3 µg/10E6 cells), Usag: Optimal dilution of the CCKBR antibody should be determined by the researcher., Presentatio: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide, Reconstitutio: Reconstitute with 0.2ml distilled water, Storag: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCKBR / Cck: Uniprot: P32239 NCBI: NM_176875 NP_795344.1

Cat: RW-52-65939-113