Rabbit anti‑Human CCKBR / Cckb Polyclonal RW-C662556-10
Antibody: CCKBR / Cckb Rabbit anti-Human Polyclonal Antibody, Application: IHC, IHC-Fr, ICC, WB, Flo, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: Cckb antibody RW-C662556 is an unconjugated rabbit polyclonal antibody to human Cckb (CCKBR). Validated for Flow, ICC, IHC and WB., Targe: Human CCKBR / Cckb, Synonym: CCKBR | CCKB | Cholecystokinin-2 receptor | CCK-BR | CCK2 receptor | CCK2-R | CCKB-R | Cholecystokinin-B | GASR | CCK-B | CCK-B receptor | CCK2R | Cckb receptor | CCKRB | Cholecystokinin B receptor | Gastrin receptor, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: Polyclonal, Conjugation: Unconjugated, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS)., Specificit: Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo., Application: IHC
IHC - Frozen
ICC
Western blot
Flow Cytometry, Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose, Reconstitutio: Add 0.2ml of distilled water will yield a concentration of 500µg/ml., Storag: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCKBR / Cck: Uniprot: P32239 NCBI: NM_176875 NP_795344.1
Cat:
RW-52-65959-113
Support & questions : Raed@gentaur.com
Read also :