Rabbit anti‑Human CCL16 / LEC IgG Polyclonal RW-C750288-20

Antibody: CCL16 / LEC Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Rat, Format: Unconjugated, Unmodified, Descriptio: LEC antibody RW-C750288 is an unconjugated rabbit polyclonal antibody to LEC (CCL16) from human. It is reactive with human and rat. Validated for WB., Targe: Human CCL16 / LEC, Synonym: CCL16 | Cc chemokine lcc-1 | CKb12 | Chemokine hcc-4 | Chemokine LEC | Chemokine lmc | ILINCK | Liver CC chemokine-1 | Monotactin-1 | NCC-4 | LCC-1 | LEC | Small-inducible cytokine A16 | Liver-expressed chemokine | LMC | New CC chemokine 4 | C-C motif chemokine 16 | Chemokine CC-4 | Chemokine ncc-4 | HCC-4 | IL-10-inducible chemokine | Mtn-1 | NCC4 | SCYA16 | SCYL4, Hos: Rabbit, Reactivit: Human, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CCL16 (NP_004581.1). MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ, Application: Western blot (1:200 - 1:2000), Usag: The predicted MW is 13kDa, while the observed MW by Western blot was 14kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCL16 / LE: Uniprot: O15467 NCBI: NM_004590 NP_004581.1

Cat: RW-52-66157-95