Rabbit anti‑Human CCL20 / MIP-3-Alpha IgG Polyclonal RW-C746793-20

Antibody: CCL20 / MIP-3-Alpha Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: MIP-3-Alpha antibody RW-C746793 is an unconjugated rabbit polyclonal antibody to human MIP-3-Alpha (CCL20). Validated for WB., Targe: Human CCL20 / MIP-3-Alpha, Synonym: CCL20 | Beta chemokine exodus-1 | Beta-chemokine exodus-1 | CKb4 | Exodus-1 | MIP-3a | MIP-3-alpha | LARC | ST38 | SCYA20 | C-C motif chemokine 20 | CC chemokine LARC | Mip-3alpha | MIP3A | Small-inducible cytokine A20, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: A synthetic peptide corresponding to a sequence within amino acids 1-95 of human CCL20 (NP_001123518.1). MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 10kDa, while the observed MW by Western blot was 15kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCL20 / MIP-3-Alph: Uniprot: P78556 NCBI: NM_004591 NP_004582.1

Cat: RW-52-66608-151