Rabbit anti‑Human CCL24 / Eotaxin 2 IgG Polyclonal RW-C335266-20
Antibody: CCL24 / Eotaxin 2 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: Eotaxin 2 antibody RW-C335266 is an unconjugated rabbit polyclonal antibody to mouse Eotaxin 2 (CCL24). Validated for WB., Targe: Human CCL24 / Eotaxin 2, Synonym: CCL24 | C-C motif chemokine 24 | Ckb-6 | CK-beta-6 | Eotaxin2 | MPIF-2 | MPIF2 | SCYA24 | Small-inducible cytokine A24 | Eotaxin-2, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 40-119 of human CCL24 (NP_002982.2). KRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC, Specificit: Human CCL24 / Eotaxin 2, Application: Western blot (1:500 - 1:1000), Usag: The predicted MW is 13kDa, while the observed MW by Western blot was 13kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCL24 / Eotaxin : Uniprot: O00175 NCBI: NM_002991 NP_002982.2
Cat:
RW-52-66905-163
Support & questions : Raed@gentaur.com
Read also :