Rabbit anti‑Human CCL25 / TECK IgG Polyclonal RW-C334787-50
Antibody: CCL25 / TECK Rabbit anti-Human Polyclonal Antibody, Application: IHC, IF, WB, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: TECK antibody RW-C334787 is an unconjugated rabbit polyclonal antibody to human TECK (CCL25). Validated for IF, IHC and WB., Targe: Human CCL25 / TECK, Synonym: CCL25 | C-C motif chemokine 25 | Ck beta-15 | TECK | Thymus-expressed chemokine | Small-inducible cytokine A25 | TECKvar | Chemokine TECK | Ckb15 | SCYA25 | Thymus expressed chemokine, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 24-150 of human CCL25 (NP_005615.2). QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL, Specificit: Human CCL25 / TECK, Application: IHC (1:100 - 1:200)
Immunofluorescence (1:50 - 1:100)
Western blot (1:500 - 1:2000), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Usag: The predicted MW is 9kDa/16kDa, while the observed MW by Western blot was Refer to Figures., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCL25 / TEC: Uniprot: O15444 NCBI: NM_005624 NP_005615.2
Cat:
RW-52-66950-114
Support & questions : Raed@gentaur.com
Read also :