Rabbit anti‑Human CCL26 / Eotaxin 3 IgG Polyclonal RW-C747212-20

Antibody: CCL26 / Eotaxin 3 Rabbit anti-Human Polyclonal Antibody, Application: IF, Reactivity: Human, Format: Unconjugated, Unmodified, Descriptio: Eotaxin 3 antibody RW-C747212 is an unconjugated rabbit polyclonal antibody to human Eotaxin 3 (CCL26). Validated for IF., Targe: Human CCL26 / Eotaxin 3, Synonym: CCL26 | CC chemokine IMAC | Ccl26 | Ccl26l | C-C motif chemokine 26 | Chemokine N1 | Eotaxin-3 | Eotaxin 3 | Eoxtaxin-3 | MIP-4-alpha | IMAC | SCYA26 | Small inducible cytokine A26 | Thymic stroma chemokine-1 | MIP-4alpha | TSC-1 | Small-inducible cytokine A26 | Eotaxin3 | MIP-4a, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 24-94 of human CCL26 (NP_006063.1). TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL, Application: Immunofluorescence (1:50 - 1:200), Usag: The predicted MW is 10kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCL26 / Eotaxin : Uniprot: Q9Y258 NCBI: NM_006072 NP_006063.1

Cat: RW-52-66969-163