Rabbit anti‑Human CCL27 IgG Polyclonal RW-C411380-20

Antibody: CCL27 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Format: Unconjugated, Unmodified, Descriptio: CCL27 antibody RW-C411380 is an unconjugated rabbit polyclonal antibody to CCL27 from human. It is reactive with human and mouse. Validated for WB., Targe: Human CCL27, Synonym: CCL27 | ALP | Chemokine alp | C-C motif chemokine 27 | CC chemokine ILC | CTAK | ESKINE | IL-11 R-alpha-locus chemokine | ILC | IL-11 Ralpha-locus chemokine | PESKY | SCYA27 | Skinkine | CTACK | Il-11r alpha-locus chemokine | Small-inducible cytokine A27, Hos: Rabbit, Reactivit: Human, Mouse (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 25-112 of human CCL27 (NP_006655.1). FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG, Specificit: Human CCL27, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 12kDa, while the observed MW by Western blot was 16kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About CCL2: Uniprot: Q9Y4X3 NCBI: NM_006664 NP_006655.1

Cat: RW-52-67039-75