Rabbit anti‑Human AATF IgG Polyclonal RW-B17062-50

Antibody: AATF Rabbit anti-Human Polyclonal (aa171-220) Antibody, Application: IHC, IHC-P, WB, Reactivity: Human, Format: Unconjugated, Unmodified, Other formats: Biotin FITC HRP, Descriptio: AATF antibody RW-B17062 is an unconjugated rabbit polyclonal antibody to human AATF (aa171-220). Validated for IHC and WB., Targe: Human AATF, Synonym: AATF | CHE1 | DED | Rb-binding protein Che-1 | CHE-1 | Protein AATF, Hos: Rabbit, Reactivit: Human (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated. Also available conjugated with Biotin, FITC, HRP., Purificatio: Immunoaffinity purified, Modification: Unmodified, Immunoge: Synthetic peptide located between aa171-220 of human AATF (Q9NY61, NP_036270) within the region EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Rabbit (100%); Monkey, Elephant (92%); Marmoset (91%); Galago (85%); Bat, Horse (84%)., Epitop: aa171-220, Specificit: Human AATF, Application: IHC
IHC - Paraffin (10 µg/ml)
Western blot (0.2 - 1 µg/ml), Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more: None, Presentatio: PBS, 0.09% sodium azide, 2% sucrose, Storag: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About AAT: Uniprot: Q9NY61 NCBI: NM_012138 NP_036270.1

Cat: RW-52-762-85